High Quality Foxo4-Dri /Foxo4 Dri/Foxo4 Peptide

Product Details
Customization: Available
Powder: Yes
Customized: Non-Customized
Diamond Member Since 2021

Suppliers with verified business licenses

Audited Supplier

Audited by an independent third-party inspection agency

Importers and Exporters
The supplier has import and export rights
In-stock Capacity
The supplier has In-stock capacity
Fast Delivery
The supplier can deliver the goods within 15 days
R&D Capabilities
The supplier has 1 R&D engineers, you can check the Audit Report for more information
to see all verified strength labels (6)
Find Similar Products

Basic Info.

Model NO.
API
Purity
>98%
Appearance
White Powder
Package
Zip Bag and Alumium Bag
Transport Package
Cardboard Drums or Cartons
Specification
1g/bag 10g/bag
Trademark
Huichem
Origin
China

Product Description

High quality FOXO4-DRI /FOXO4 DRI/FOXO4 peptide
Product Description

FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al.

FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.

Packaging & Shipping
By Express By Air By Sea
Suitable for under 50kg Suitable for more than 50kg Suitable for more than 500kg
Fast: 3-7 days Fast: 3-7 days Slow: 3-10 days
High cost Medium cost Medium cost
Door to door service Port to port service Port to port service
 
Company Profile

Shanghai HuiRui Chemical Technology Co., Ltd.(HuiChem) is a high-tech enterprise engaged in the area of health care & nutrition. HuiChem have been working closely with our customers we deliver products and solutions that create value and competitive advantage while positively impacting the world we live in, as well as attentive service for the purpose to meet the demand of customers, spare no effort to create value for customers.
HuiChem is now headquartered in Shanghai, and has offices in Jiangsu, Shandong, Anhui and HongKong. Its Shanghai headquarters has nearly 2000 square meters of operation premises, including a total of over 1500 square meters of synthesis laboratories and more than 200 square meters of analysis laboratories (equipped with AAS, LC-MS, FTIR, NMR and other basic test equipment). We have set up two pilot scale laboratories, which lay speedy and stable foundation for process amplification and production of superior products. Besides, we have partner factories that are responsible for the commercial production in Jiangsu Province and Shandong Province. All of those, ensuring growing customer demand and smooth commercial production. We have been certified ISO9001:2008 and ISO14001:2004. The company has established good cooperative relationships with Shanghai Institute of Organic Chemistry of Chinese Academy of Sciences(SIOC), Shanghai Institute of Materia Medica (SIMM), University of Science and Technology of China and Fudan University, and carried out a variety of creative R&D cooperation activities. 
We attach great importance to technical innovation and follow the latest dynamic of discovery and development to research and develop new products relying on advanced technology of synthetic chemistry, medicinal chemistry, biochemistry and analytical chemistry. We also pay attention to introduce and foster professional and technical personnel, the company has a group of vigorous and well-trained employees, and strong technical R&D forces. HuiChem has established a new system covering research and development, production and sales. Based on advanced equipment and strict management, always pursue the "open, inclusion, innovation, sharing" business philosophy, creating a win-win cooperation platform.
Everything originates from innovation. HuiChem combines the power of science and the passion of innovation. We believe to connect chemistry and innovation with the principles of sustainability to create a healthy life.

Our Advantages

1. Faster delivery: Sample order in stock and 3-7 days for bulk production.
2. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.
3. After-Sale Service: 
1)International Authorized Third-Party Test For The Products You Demand. 
2)60 Days Warranty of quality of goods.

FAQ

Q1. How does your factory control quality?


All the raw material purchasing and production quality control are strictly following the ISO9001: 2008 management system. Besides, the full-featured detection equipment and GMP quality management system to provide the strongest guarantee for high quality product. We can provide our customers the detailed test report for the quality evaluation before the sample.

Q2. What's your main markets? 
North America, Europe, Asia, etc.

Q3. What is your delivery term and delivery period? 
We accept FOB, CIF, etc. You can choose the one which is the most convenient or cost effective for you. The sample within 3 days, and bulk order within 5 days.

Q4. What is your package?
Powder: PE bag, glass bottle or PTFE bottle for inner packing, and aluminium foil bag for outer packing.
Liquid: glass bottle or PTFE bottle for inner packing, and aluminium foil bag for outer packing.
Bulk order: Fiber drum or steel drum.

Q5. What is the payment term? 
We can accept T/T, Western Union, L/C and bank transfer.

Q6. Will you supply samples for test the quality? 
We'd like to offer our customers the free samples for the quality evaluation for most products, but the shipping cost is borne by customers.
 

Send your message to this supplier

*From:
*To:
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now
Contact Supplier